Rana temporaria (common frog): 120933619 Help Entry 120933619         CDS       T07929                                  Name (RefSeq) claudin-15-like   KO K06087   claudin Organism rtem  Rana temporaria (common frog) Pathway rtem03272   Virion - Hepatitis viruses rtem04382   Cornified envelope formation rtem04514   Cell adhesion molecule (CAM) interaction rtem04530   Tight junction Brite KEGG Orthology (KO) [BR:rtem00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     120933619  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     120933619  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     120933619  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     120933619  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:rtem03037]     120933619    04147 Exosome [BR:rtem04147]     120933619 Cilium and associated proteins [BR:rtem03037]  Other cilia and associated proteins   Stereociliary proteins    120933619 Exosome [BR:rtem04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    120933619   Exosomal proteins of colorectal cancer cells    120933619 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Motif Other DBs NCBI-GeneID:  120933619 NCBI-ProteinID:  XP_040202856 LinkDB All DBs Position 3:complement(468758686..468805065) Genome browser AA seq 156 aa AA seqDB search MSMIVEATGFFFGVIGSIMLGIALFDANWRVSSDDGSVIITSVLFENLWMSCATDSTGVY NCREFPSLLALSGHLQAFRALIISSLIFGLFSCLCGMIGLQCTKVAEGNSVLKGKFITAA GAISIFCRYLCWGFRLLVRVQYYQGLLQPTVPRNQV NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atgtcaatgatcgtggaggcgacgggattcttctttggggtcataggctccatcatgttg ggcatcgcgctcttcgacgcaaactggagggtgtcttcggatgacggaagcgtgatcatc acctccgtcctgtttgagaacctgtggatgagctgtgccaccgattccaccggagtgtac aactgccgagaattcccgtccttgctggctctttcaggtcacctgcaggctttccgggcc ctgatcatatcatcgttgattttcggcttgttctcgtgtctgtgtgggatgattggactg cagtgtacgaaggtcgccgaggggaattctgtactgaagggcaagtttatcacagcagct ggagctatatccatattttgccggtatctgtgctggggtttccgtctcttggtacgcgtt caatattaccaaggacttcttcaacccactgttcccaggaaccaagtatga

DBGET integrated database retrieval system