Rana temporaria (common frog): 120942888 Help Entry 120942888         CDS       T07929                                  Symbol ELOB Name (RefSeq) elongin-B isoform X1   KO K03873   elongin-B Organism rtem  Rana temporaria (common frog) Pathway rtem04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:rtem00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     120942888 (ELOB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:rtem04121]     120942888 (ELOB)    03400 DNA repair and recombination proteins [BR:rtem03400]     120942888 (ELOB) Ubiquitin system [BR:rtem04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      120942888 (ELOB)    Cul5 complex      120942888 (ELOB) DNA repair and recombination proteins [BR:rtem03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      120942888 (ELOB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  120942888 NCBI-ProteinID:  XP_040211763 LinkDB All DBs Position 6:complement(841251..850625) Genome browser AA seq 120 aa AA seqDB search MADVFLMIRHGKTTIFTDAKENTTVYELKRIVEGILKRAPEDQRLYKDDQLLDDNKSLGD CGFTSQTARPQAPATVGLAFRCSGDSFEPLRIEPFSSPPELPDVMKPQETSGSANEQAVQ NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atggcggatgtttttttgatgatccgtcatggcaagaccacaatcttcaccgacgccaag gagaacaccacagtgtatgagctgaagaggattgtggaaggaatcttaaagcgagctcct gaagaccagagattgtacaaggacgaccagctcctagatgataataaaagcctgggcgac tgtggcttcaccagtcagaccgcgcgcccccaggctccagccacagtgggattagctttc cgctgctcgggtgactccttcgagcctctccgaatagagcccttctccagcccgcccgag ctccccgatgtcatgaaaccacaggagacgagtggcagcgctaatgaacaggccgtgcag tga

DBGET integrated database retrieval system