Rana temporaria (common frog): 120944999 Help Entry 120944999         CDS       T07929                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism rtem  Rana temporaria (common frog) Pathway rtem04081   Hormone signaling rtem04144   Endocytosis rtem04150   mTOR signaling pathway rtem04270   Vascular smooth muscle contraction rtem04310   Wnt signaling pathway rtem04350   TGF-beta signaling pathway rtem04510   Focal adhesion rtem04520   Adherens junction rtem04530   Tight junction rtem04621   NOD-like receptor signaling pathway rtem04625   C-type lectin receptor signaling pathway rtem04810   Regulation of actin cytoskeleton rtem05100   Bacterial invasion of epithelial cells rtem05132   Salmonella infection Brite KEGG Orthology (KO) [BR:rtem00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     120944999 (RHOA)    04350 TGF-beta signaling pathway     120944999 (RHOA)    04150 mTOR signaling pathway     120944999 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     120944999 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     120944999 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     120944999 (RHOA)    04520 Adherens junction     120944999 (RHOA)    04530 Tight junction     120944999 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     120944999 (RHOA)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     120944999 (RHOA)    04625 C-type lectin receptor signaling pathway     120944999 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     120944999 (RHOA)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120944999 (RHOA)    05100 Bacterial invasion of epithelial cells     120944999 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rtem04131]     120944999 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rtem04147]     120944999 (RHOA)    04031 GTP-binding proteins [BR:rtem04031]     120944999 (RHOA) Membrane trafficking [BR:rtem04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     120944999 (RHOA) Exosome [BR:rtem04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120944999 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    120944999 (RHOA)   Exosomal proteins of colorectal cancer cells    120944999 (RHOA)   Exosomal proteins of bladder cancer cells    120944999 (RHOA) GTP-binding proteins [BR:rtem04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     120944999 (RHOA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  120944999 NCBI-ProteinID:  XP_040214744 LinkDB All DBs Position 7:7159994..7187132 Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELTKMKQEPVKPEEGRDMANRISAYGYMECSAKTKDGVREVFELATRAALQ ARRGKKKTTCLLI NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatccgtaagaaactcgtcatcgttggagatggggcgtgcgggaagacgtgc cttctgatagtgtttagtaaagaccaattcccggaagtctacgtccccacagtgtttgag aactatgtggccgacattgaggtggacagtaaacaggtggaactcgccttgtgggacaca gccggacaggaagactacgacagactgagacctctgtcctatccagacacagatgttata ttaatgtgcttctccatcgacagccctgacagtttagaaaacatccctgagaagtggact ccggaagtaaaacatttctgccccaatgtgcccatcatcctggtggggaacaagaaggac ctgcgtaatgacgagcacacccgccgagagctgacaaagatgaaacaggagccagtaaag ccggaggaagggcgcgacatggctaacaggatctcggcttacggctacatggagtgctcc gctaagacaaaagatggcgtccgagaggtgttcgagctggccacaagggcggctctgcaa gccagacgtggcaagaagaaaaccacgtgccttctcatctaa

DBGET integrated database retrieval system