Rana temporaria (common frog): 120945095 Help Entry 120945095         CDS       T07929                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism rtem  Rana temporaria (common frog) Pathway rtem04137   Mitophagy - animal rtem04140   Autophagy - animal rtem04144   Endocytosis rtem04145   Phagosome rtem04148   Efferocytosis rtem05132   Salmonella infection Brite KEGG Orthology (KO) [BR:rtem00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     120945095 (RAB7A)    04145 Phagosome     120945095 (RAB7A)    04140 Autophagy - animal     120945095 (RAB7A)    04137 Mitophagy - animal     120945095 (RAB7A)    04148 Efferocytosis     120945095 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120945095 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rtem04131]     120945095 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rtem04147]     120945095 (RAB7A)    04031 GTP-binding proteins [BR:rtem04031]     120945095 (RAB7A) Membrane trafficking [BR:rtem04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     120945095 (RAB7A) Exosome [BR:rtem04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120945095 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    120945095 (RAB7A)   Exosomal proteins of colorectal cancer cells    120945095 (RAB7A)   Exosomal proteins of bladder cancer cells    120945095 (RAB7A) GTP-binding proteins [BR:rtem04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     120945095 (RAB7A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW nSTAND3 Septin PduV-EutP AAA_7 AAA_24 AAA_22 AAA_16 AAA_5 FLYWCH_N NTPase_1 ATPase_2 SRPRB NB-ARC NACHT AAA_14 ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  120945095 NCBI-ProteinID:  XP_040214893 LinkDB All DBs Position 7:complement(15167074..15224013) Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFTNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRSQVWCHSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRAKGSAETCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacgtccagaaagaaagtgcttctgaaggtcattatcctgggggattctggggttggc aagacttctcttatgaaccagtatgttaataagaaatttactaaccagtacaaggccaca atcggggctgactttctcaccaaggaggtgatggtggatgaccggctggtcacaatgcag atatgggacacagctgggcaggagcgattccagtcacttggtgtggccttctaccgaggg gcagactgctgcgttttggttttcgatgttactgcgcccaacactttcaaaactttggac agctggagagatgaattccttattcaggccagtccacgggaccctgaaaacttccccttt gttgtcctggggaacaagatagaccttgaaaacagacaagtcaccacaaagcgatcacag gtctggtgtcatagcaaaaataacatcccgtactttgaaaccagtgctaaagaggctata aatgtggagcaggctttccagaccattgcacggaatgcacttaaacaggaaacagaggtg gagctctacaatgaattcccagagcccattaaactggacaagaacgaccgggcaaagggc tcggcggagacctgcagctgctga

DBGET integrated database retrieval system