Rana temporaria (common frog): 120945230 Help Entry 120945230         CDS       T07929                                  Symbol ARF4 Name (RefSeq) ADP-ribosylation factor 4   KO K07939   ADP-ribosylation factor 4 Organism rtem  Rana temporaria (common frog) Pathway rtem04144   Endocytosis Brite KEGG Orthology (KO) [BR:rtem00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     120945230 (ARF4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rtem04131]     120945230 (ARF4)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rtem04147]     120945230 (ARF4)    04031 GTP-binding proteins [BR:rtem04031]     120945230 (ARF4) Membrane trafficking [BR:rtem04131]  Endosome - Golgi transport   Arf GTPases and associated proteins    Arf GTPases     120945230 (ARF4) Exosome [BR:rtem04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120945230 (ARF4)   Exosomal proteins of other body fluids (saliva and urine)    120945230 (ARF4)   Exosomal proteins of colorectal cancer cells    120945230 (ARF4) GTP-binding proteins [BR:rtem04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     120945230 (ARF4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Arf Roc SRPRB G-alpha Ras Gtr1_RagA MMR_HSR1 GTP_EFTU 6PF2K FLAD1_M RXYLT1_N cobW Csa3_N AAA_18 Motif Other DBs NCBI-GeneID:  120945230 NCBI-ProteinID:  XP_040215169 LinkDB All DBs Position 7:37453197..37472412 Genome browser AA seq 180 aa AA seqDB search MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN ICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIQEAAEELQKMLQEDELREAA LLVFANKQDLPNAMAISEMTDKLALQCLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR NT seq 543 nt NT seq  +upstreamnt  +downstreamnt atgggcctcaccatctcctccctcttctcccggctcttcggaaagaaacagatgcggatt ctgatggtcggtcttgatgccgctggaaaaacaacaattctgtacaagctgaagctcgga gagattgtcacaaccatcccaacaattggtttcaatgtggaaactgtagaatacaaaaat atctgtttcaccgtctgggatgttggtggccaggataaaatccgacccctctggaggcat tacttccagaatacacagggcctcatttttgttgtagatagtaatgacagagagcgaatc caggaggcagcagaagagttacagaaaatgcttcaggaagatgagctgagagaggcagcg ttgttggtatttgcaaacaaacaagatttgcccaatgccatggccatcagtgagatgact gacaagctggcacttcagtgtctccgcaacagaacttggtacgtgcaagcaacatgtgca actcagggcacaggtctgtatgaaggactggactggctatctaacgagctttccaagcgt taa

DBGET integrated database retrieval system