Ruoffia tabacinasalis: VQP54_11610 Help Entry VQP54_11610       CDS       T10899                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rtf  Ruoffia tabacinasalis Pathway rtf01100   Metabolic pathways rtf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rtf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     VQP54_11610    00074 Mycolic acid biosynthesis     VQP54_11610   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     VQP54_11610 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C DUF1493 SP_0191-like Motif Other DBs NCBI-ProteinID:  WWL40325 LinkDB All DBs Position 2314632..2314853 Genome browser AA seq 73 aa AA seqDB search MFEKIKEIIVDQLGVEENEVTLETSFENDLEADSLDIFQVINEIEDEFDITIDTDQDLKT VGDLVSYVEGLDK NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgtttgaaaaaattaaagaaattatcgtggatcaattaggtgtagaagagaatgaagta actttagaaactagctttgaaaatgacttagaagcagatagcttagatatcttccaagta atcaatgaaattgaagacgaattcgatattacaattgatacagaccaagacttaaaaaca gttggagatttagttagttacgtagaaggattagacaaataa

DBGET integrated database retrieval system