Raoultella terrigena: NCTC13098_00157 Help Entry NCTC13098_00157   CDS       T06046                                  Symbol secB Name (GenBank) Protein-export protein SecB   KO K03071   preprotein translocase subunit SecB Organism rtg  Raoultella terrigena Pathway rtg02024   Quorum sensing rtg03060   Protein export rtg03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:rtg00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     NCTC13098_00157 (secB)  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     NCTC13098_00157 (secB)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     NCTC13098_00157 (secB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:rtg03110]     NCTC13098_00157 (secB)   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:rtg02044]     NCTC13098_00157 (secB) Chaperones and folding catalysts [BR:rtg03110]  Other chaperones and cochaperones   SecB    NCTC13098_00157 (secB) Secretion system [BR:rtg02044]  Sec (secretion) system   Prokaryotic Sec-SRP core components    NCTC13098_00157 (secB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SecB Motif Other DBs NCBI-ProteinID:  VDR23885 UniProt:  A0A3P8K5A5 LinkDB All DBs Position 1:135816..136118 Genome browser AA seq 100 aa AA seqDB search MKWCWRVTVTAALGEETAFLCEVQQGGIFSIEGIDGNQMAHCLGAYCPNILFPYARECIT SLVSRGTFPQLNLAPVNFDALFMNYLQQQAGEGAEQHQDA NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgaagtggtgctggcgtgtgaccgtaaccgccgcgctgggcgaagaaaccgcattcctg tgtgaagtacagcagggcggtattttctccatcgaaggcattgacggcaaccagatggcg cattgcctcggtgcatactgcccgaacatcctgttcccgtatgcgcgtgagtgcattacc agcctggtttctcgcggtaccttcccgcaactgaaccttgcgccagtgaacttcgatgcg ctgttcatgaactatctgcagcagcaggctggcgaaggtgccgaacaacatcaggatgcc tga

DBGET integrated database retrieval system