Rhodanobacter thiooxydans: LRK53_10135 Help Entry LRK53_10135       CDS       T08065                                  Name (GenBank) phenol hydroxylase subunit   KO K16249   phenol/toluene 2-monooxygenase (NADH) P0/A0 Organism rth  Rhodanobacter thiooxydans Pathway rth00361   Chlorocyclohexane and chlorobenzene degradation rth00362   Benzoate degradation rth00623   Toluene degradation rth01100   Metabolic pathways rth01120   Microbial metabolism in diverse environments rth01220   Degradation of aromatic compounds Module rth_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:rth00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     LRK53_10135    00361 Chlorocyclohexane and chlorobenzene degradation     LRK53_10135    00623 Toluene degradation     LRK53_10135 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Phenol_hyd_sub Motif Other DBs NCBI-ProteinID:  UJJ53357 LinkDB All DBs Position 2266393..2266650 Genome browser AA seq 85 aa AA seqDB search MNASTQPAFRQPATTVRVTGGIGQRFVQFEFSLGDPDLTVELVMRPEQFREFCARHHSRF LSDPECAAVDAERLKWRYGKPDVES NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaatgcatcaacccagccggcatttcgccaacccgcgacgacggtgcgcgtcaccggg ggcatcgggcagcgcttcgtgcagttcgagttttccctgggcgatccggatttgaccgtg gagctggtaatgcggcccgagcagtttcgcgagttctgtgcccggcatcacagccgtttc ctgtcagacccggagtgcgcagccgtggacgccgagcggctgaaatggcgttacggcaaa cccgacgtcgagagctga

DBGET integrated database retrieval system