Rhodanobacter thiooxydans: LRK53_10145 Help Entry LRK53_10145       CDS       T08065                                  Name (GenBank) MmoB/DmpM family protein   KO K16244   phenol/toluene 2-monooxygenase (NADH) P2/A2 [EC:1.14.13.244 1.14.13.243] Organism rth  Rhodanobacter thiooxydans Pathway rth00361   Chlorocyclohexane and chlorobenzene degradation rth00362   Benzoate degradation rth00623   Toluene degradation rth01100   Metabolic pathways rth01120   Microbial metabolism in diverse environments rth01220   Degradation of aromatic compounds Module rth_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:rth00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     LRK53_10145    00361 Chlorocyclohexane and chlorobenzene degradation     LRK53_10145    00623 Toluene degradation     LRK53_10145 Enzymes [BR:rth01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      LRK53_10145     1.14.13.244  phenol 2-monooxygenase (NADH)      LRK53_10145 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MmoB_DmpM Motif Other DBs NCBI-ProteinID:  UJJ53359 LinkDB All DBs Position 2267730..2267999 Genome browser AA seq 89 aa AA seqDB search MNNNVFIALQTSDEARAIIDAILDDNPAATRSDFPAMVKIDAPGRLVVRRESVGQRLGRD WDLQELHLSLISLSGNIDESDDEFCLVRG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgaacaacaacgtcttcatcgccctgcaaaccagcgacgaggcccgcgccatcatcgat gcgatcctcgatgacaaccctgcggccacacgttcggatttccccgccatggtgaagatc gatgcgccgggacggctggtcgtgcggcgcgagtccgtgggccaacgcctgggtcgcgac tgggacctgcaggaactgcacctcagcctgatctcgctgtcgggaaacatcgacgaaagc gacgacgaattctgtctggtccgcggctga

DBGET integrated database retrieval system