Rhodanobacter thiooxydans: LRK53_16280 Help Entry LRK53_16280       CDS       T08065                                  Symbol ftsL Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism rth  Rhodanobacter thiooxydans Brite KEGG Orthology (KO) [BR:rth00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:rth03036]     LRK53_16280 (ftsL) Chromosome and associated proteins [BR:rth03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     LRK53_16280 (ftsL) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FtsL DivIC Motif Other DBs NCBI-ProteinID:  UJJ56600 LinkDB All DBs Position complement(3586267..3586506) Genome browser AA seq 79 aa AA seqDB search MLLIAVLVSALGVVWTRHESRVLFVNLTALQNQRDELNIEYGKLELEQATYAEPRRIDDE ARQKLGMVDPRPQDIRLLR NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgctgctgatcgcggtgctggtcagcgcgctcggcgtggtgtggacgcgccacgagagt cgcgtgctgttcgtcaacctgactgcgctgcagaaccagcgcgacgagctgaacatcgag tacggcaagctcgagctggagcaggccacctatgccgaaccgcggcgcatcgacgacgag gcccggcagaagctgggcatggtcgatccgcgtccgcaagacatccggttgctgcgctga

DBGET integrated database retrieval system