KEGG Orthology (KO) [BR:rthe00001]
09120 Genetic Information Processing
09121 Transcription
03020 RNA polymerase
98121893 (VTJ83DRAFT_1124)
09124 Replication and repair
03420 Nucleotide excision repair
98121893 (VTJ83DRAFT_1124)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03021 Transcription machinery [BR:rthe03021]
98121893 (VTJ83DRAFT_1124)
03400 DNA repair and recombination proteins [BR:rthe03400]
98121893 (VTJ83DRAFT_1124)
Transcription machinery [BR:rthe03021]
Eukaryotic type
RNA polymerase II system
RNA polymerase II
Pol I, II, III common subunits
98121893 (VTJ83DRAFT_1124)
RNA polymerase III system
RNA polymerase III
98121893 (VTJ83DRAFT_1124)
RNA polymerase I system
RNA polymerase I
98121893 (VTJ83DRAFT_1124)
DNA repair and recombination proteins [BR:rthe03400]
Eukaryotic type
SSBR (single strand breaks repair)
NER (nucleotide excision repair)
TCR (transcription coupled repair) factors
DNA-directed RNA polymerase II complex
98121893 (VTJ83DRAFT_1124)
160 aa
MSDYGNDDDRDRDLNDEPAYEDDPDEYYEPEPEPADEDEAARAQDQDGENHDADHVVASG
DPNAAANHGRGNEKSHKDKKIPNDQRTTTPFMTKYERARILGTRALQISMNAPVLVDLEG
ETDPLQIAIKELREKKIPLIVRRYLPDGYYEDWTCEELLQ
