Remersonia thermophila: 98127890
Help
Entry
98127890 CDS
T10833
Symbol
VTJ83DRAFT_6525
Name
(RefSeq) hypothetical protein
KO
K27383
non-classical export protein 1
Organism
rthe Remersonia thermophila
Brite
KEGG Orthology (KO) [BR:
rthe00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
rthe02000
]
98127890 (VTJ83DRAFT_6525)
Transporters [BR:
rthe02000
]
Other transporters
Others
98127890 (VTJ83DRAFT_6525)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
NCE101
CNNM
Motif
Other DBs
NCBI-GeneID:
98127890
NCBI-ProteinID:
XP_070864152
JGI:
Remth1_6525
LinkDB
All DBs
Position
6:complement(join(1210272..1210302,1210366..1210511))
Genome browser
AA seq
58 aa
AA seq
DB search
MAAPVYIISRVADPIFAVFIGISAAALRINREEKEKGRTTQETIEALRRRIAYHLKST
NT seq
177 nt
NT seq
+upstream
nt +downstream
nt
atggctgcgccggtatacatcatctcgagggtcgcggacccgattttcgccgtcttcatt
ggcatttctgcggccgccctgaggatcaaccgcgaggagaaagagaagggcaggacgacg
caggagaccatcgaggcgctacgtcgccgcatcgcataccacttgaagagcacgtaa
DBGET
integrated database retrieval system