Rhodococcus triatomae: G4H71_02510 Help Entry G4H71_02510       CDS       T06846                                  Name (GenBank) ATP synthase F0 subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism rtm  Rhodococcus triatomae Pathway rtm00190   Oxidative phosphorylation rtm01100   Metabolic pathways Module rtm_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:rtm00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     G4H71_02510  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:rtm00194]     G4H71_02510 Photosynthesis proteins [BR:rtm00194]  Photosystem and electron transport system   F-type ATPase [OT]    G4H71_02510 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  QNG22060 LinkDB All DBs Position complement(536768..537010) Genome browser AA seq 80 aa AA seqDB search MSLAYLAQEAVETNVTGYGAIGFGLAAIGPGIGIGILVGKAMESMVRQPEMAGQVRTTMF LGIAFTEALALIGLVAGFIF NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgagcctcgcgtacctggcacaggaagcggtcgagaccaacgtcaccggctacggcgcc atcggcttcggcctcgccgccatcggccccggcatcggcatcggcatcctcgtcggtaag gcaatggagagcatggtccgtcagcccgagatggccggacaggttcgtaccaccatgttc ctcggtatcgcgttcaccgaggcactcgccctgatcggccttgtcgccggcttcattttc taa

DBGET integrated database retrieval system