Rathayibacter tritici: A6122_0095 Help Entry A6122_0095        CDS       T04388                                  Name (GenBank) coronafacic acid synthetase   KO K02078   acyl carrier protein Organism rtn  Rathayibacter tritici Pathway rtn01100   Metabolic pathways rtn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rtn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A6122_0095    00074 Mycolic acid biosynthesis     A6122_0095   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A6122_0095 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C SNN_cytoplasm Motif Other DBs NCBI-ProteinID:  AND15264 UniProt:  A0A160KQ15 LinkDB All DBs Position 102738..103010 Genome browser AA seq 90 aa AA seqDB search MTNLTPNGTEVEAAIIVMLRDDLYVEEEFGVDDSLRDDLGLDSLGFVELRSACEKKFGIA ITESDFDSTNFGTVRNLAMLVARNVRALSA NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaccaatcttacgccgaacgggaccgaggtcgaggcggcgatcatcgttatgctccgc gacgacctgtatgtcgaagaagagttcggagtcgatgattctctccgggatgatctcggt ctcgattctttgggtttcgtcgagctccgatctgcatgcgagaagaaattcggaattgcg atcaccgagtcagatttcgattcgacaaatttcggcactgtgcggaacctagcaatgctc gtagcgcggaacgtcagggcgctctccgcatga

DBGET integrated database retrieval system