KEGG   Ruminococcus torques: RTO_20500
Entry
RTO_20500         CDS       T02606                                 
Name
(GenBank) pantetheine-phosphate adenylyltransferase, bacterial
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
rto  Ruminococcus torques
Pathway
rto00770  Pantothenate and CoA biosynthesis
rto01100  Metabolic pathways
rto01240  Biosynthesis of cofactors
Module
rto_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:rto00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    RTO_20500
Enzymes [BR:rto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     RTO_20500
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-ProteinID: CBL26579
UniProt: D4M5R7
LinkDB
Position
2127936..2128427
AA seq 163 aa
MLKAIYPGSFDPVTRGHYDIICRSCKIVDKLIVGVLNNKAKMPLFSVEERVKMLKEVTKD
LPNVEIIPFDGLLVDFAEQIGADVVIRGLRAITDFEYELQMSQTNQRMKPDIETMFLTTS
IEYSYLSSTTVREIAAFGGDVSQFVPEAVEIALREKMKEKRRV
NT seq 492 nt   +upstreamnt  +downstreamnt
atgttaaaagcaatttatccgggaagttttgaccctgttacccgtggacattatgatatc
atttgcagatcttgtaaaatcgtagacaaattaattgtcggagtactgaataataaagca
aaaatgccgttgttttctgtagaagaacgtgttaaaatgttaaaggaagtgacgaaagat
ctgccgaatgttgagattataccatttgatggattgctggtagactttgcggaacagata
ggtgcagatgtggttatcaggggattacgtgcgattaccgattttgaatatgagctgcag
atgtcgcagacgaatcagaggatgaagcctgatatagagaccatgtttctgacaacaagt
atagaatattcttatttaagttcgactacagtgcgggagatcgccgcttttggaggagac
gtatcacagtttgtgccggaagccgtcgagatcgcacttagagaaaagatgaaagaaaaa
aggagagtgtaa

DBGET integrated database retrieval system