KEGG   Rhincodon typus (whale shark): 109911771
Entry
109911771         CDS       T06055                                 
Name
(RefSeq) superoxide dismutase [Cu-Zn]-like
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
rtp  Rhincodon typus (whale shark)
Pathway
rtp04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109911771
Enzymes [BR:rtp01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     109911771
SSDB
Motif
Pfam: Sod_Cu
Other DBs
NCBI-GeneID: 109911771
NCBI-ProteinID: XP_048458895
LinkDB
Position
11:complement(56218196..56258107)
AA seq 158 aa
MEIRKAICVLKGPGSATGTICFKTEEGAHSTCITGEITGLTPGKHGFHVHTYGDISKGCG
SAGPHYNPCNETHGAPEDKKRHVGDLGNIEADENGVACVDMVDRLLRLAGKYSIIGRTLV
VNEKEDDLGKGGNKESLESGNHGAGVAWGIIGIDEDPK
NT seq 477 nt   +upstreamnt  +downstreamnt
atggagattaggaaggccatttgtgtcctgaagggtcccggttctgctactggcacaatt
tgtttcaaaacagaggaaggtgcacattcgacttgtataaccggagaaattactggattg
actcctggaaaacatggatttcatgtgcacacatatggtgacatatctaaaggctgtggc
agtgctggacctcattataacccttgtaatgaaactcacggagcaccagaagacaaaaag
agacatgtaggtgacctggggaacatagaagctgatgaaaatggagtagcttgtgttgat
atggtagaccgacttcttcgcctggcaggaaagtattctattattggacgtaccttggtg
gttaatgaaaaggaagatgatctgggcaaaggtggtaacaaggagagtcttgaatcagga
aaccatggagcaggcgtagcctggggtataattggaatagatgaggaccccaagtaa

DBGET integrated database retrieval system