Rhincodon typus (whale shark): 109917328 Help Entry 109917328         CDS       T06055                                  Symbol nras Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism rtp  Rhincodon typus (whale shark) Pathway rtp04010   MAPK signaling pathway rtp04012   ErbB signaling pathway rtp04068   FoxO signaling pathway rtp04137   Mitophagy - animal rtp04140   Autophagy - animal rtp04150   mTOR signaling pathway rtp04210   Apoptosis rtp04218   Cellular senescence rtp04370   VEGF signaling pathway rtp04371   Apelin signaling pathway rtp04540   Gap junction rtp04625   C-type lectin receptor signaling pathway rtp04810   Regulation of actin cytoskeleton rtp04910   Insulin signaling pathway rtp04912   GnRH signaling pathway rtp04916   Melanogenesis Brite KEGG Orthology (KO) [BR:rtp00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109917328 (nras)    04012 ErbB signaling pathway     109917328 (nras)    04370 VEGF signaling pathway     109917328 (nras)    04371 Apelin signaling pathway     109917328 (nras)    04068 FoxO signaling pathway     109917328 (nras)    04150 mTOR signaling pathway     109917328 (nras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     109917328 (nras)    04137 Mitophagy - animal     109917328 (nras)   09143 Cell growth and death    04210 Apoptosis     109917328 (nras)    04218 Cellular senescence     109917328 (nras)   09144 Cellular community - eukaryotes    04540 Gap junction     109917328 (nras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     109917328 (nras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     109917328 (nras)   09152 Endocrine system    04910 Insulin signaling pathway     109917328 (nras)    04912 GnRH signaling pathway     109917328 (nras)    04916 Melanogenesis     109917328 (nras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rtp04131]     109917328 (nras)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rtp04147]     109917328 (nras)    04031 GTP-binding proteins [BR:rtp04031]     109917328 (nras) Membrane trafficking [BR:rtp04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     109917328 (nras)  Endocytosis   Macropinocytosis    Ras GTPases     109917328 (nras) Exosome [BR:rtp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109917328 (nras)   Exosomal proteins of other body fluids (saliva and urine)    109917328 (nras)   Exosomal proteins of breast cancer cells    109917328 (nras)   Exosomal proteins of colorectal cancer cells    109917328 (nras) GTP-binding proteins [BR:rtp04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     109917328 (nras) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  109917328 NCBI-ProteinID:  XP_048467946 LinkDB All DBs Position 25:complement(38288991..38352621) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNNKSFADVHLYREQIKRVKDSEDVPMVLVGNKCDL PARTVDTKQAQELARSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMIKLNSQDDRNQG CLGLKCIIM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggaatataagctggtagtggtcggagctggtggtgtgggaaagagtgccttgacg atccagttgattcagaaccactttgttgatgaatacgatccaacaattgaggactcctat aggaaacaggtagtgattgatggtgaaacatgtttattagacattctggatacggcaggt caagaggagtatagtgctatgagggatcaatacatgaggacaggagaaggattcctttgt gtatttgccataaataataataaatcttttgcagatgttcacttgtacagagaacagatt aaacgagtaaaggattctgaagatgttcccatggtattggtggggaacaaatgtgatcta cctgcccggacagtggatacgaaacaagcacaggaactagctaggagttatgggatacct ttcatagaaacctcagcaaagacaagacagggagttgaagatgcattttacacactggta cgagagattcggcagtacagaatgataaaactcaacagtcaagatgatagaaaccaaggc tgcttgggattaaaatgcattattatgtaa

DBGET integrated database retrieval system