Rhincodon typus (whale shark): 109919666 Help Entry 109919666         CDS       T06055                                  Name (RefSeq) stefin-C-like   KO K13907   cystatin-A/B Organism rtp  Rhincodon typus (whale shark) Brite KEGG Orthology (KO) [BR:rtp00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:rtp01002]     109919666   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rtp04147]     109919666 Peptidases and inhibitors [BR:rtp01002]  Peptidase inhibitors   Family I25: cystatin family    109919666 Exosome [BR:rtp04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    109919666 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cystatin Motif Other DBs NCBI-GeneID:  109919666 NCBI-ProteinID:  XP_020375283 LinkDB All DBs Position 48:3174471..3177342 Genome browser AA seq 91 aa AA seqDB search MEATTSDIQAIVQLLKNSVVEKLNRPLHVYHAISYRSQVVAGMNYFIKVVIGDADDYIHI RVFQPLPSSDAKLSLEKIQTNKKLFDELEYF NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atggaagccacgactagcgacattcaggccattgtccagttattgaagaactccgttgtg gaaaagttgaatcgcccgctgcatgtttatcacgcgatctcatatcggtctcaagtggtg gctggaatgaattacttcattaaggttgtgattggggatgctgatgattacatacacata cgggtgttccagccactgccctcttctgatgccaaactgtccctggaaaaaatccaaaca aacaagaaactgtttgatgagctggagtacttctag

DBGET integrated database retrieval system