Rhincodon typus (whale shark): 109919953 Help Entry 109919953         CDS       T06055                                  Name (RefSeq) sialomucin core protein 24-like   KO K06546   CD164 antigen Organism rtp  Rhincodon typus (whale shark) Pathway rtp04142   Lysosome biogenesis Brite KEGG Orthology (KO) [BR:rtp00001]  09140 Cellular Processes   09141 Transport and catabolism    04142 Lysosome biogenesis     109919953  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04090 CD molecules [BR:rtp04090]     109919953 CD molecules [BR:rtp04090]  Proteins   109919953 SSDB OrthologParalogGFIT Motif Pfam:  MGC-24 C1orf162 Motif Other DBs NCBI-GeneID:  109919953 NCBI-ProteinID:  XP_048452969 LinkDB All DBs Position 5:21414204..21430829 Genome browser AA seq 99 aa AA seqDB search MLTSVPATITSTSAIANSSNSSTSVPVTQISSLAPNATSLGTTAGTPNGTTPVPPPPSKK STFDAASFIGGIVLVLGLQAVIFFAVKFCKTKDRNYHTL NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgttgacttcagtccctgcaaccataacttcaacttctgcaattgccaattcttcaaac tcttctacttcagttcctgtcacgcaaattagctctctggcacccaatgccaccagcctt ggtactacagcaggtacacctaatgggacgactccagtaccacctccgccctctaagaaa tctacctttgatgcagcaagtttcattgggggaattgtacttgtgcttggattgcaagct gtaatcttttttgctgtgaagttctgcaaaactaaggataggaactaccacacgctctaa

DBGET integrated database retrieval system