Rhincodon typus (whale shark): 109920697 Help Entry 109920697         CDS       T06055                                  Symbol rab8a Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism rtp  Rhincodon typus (whale shark) Pathway rtp04140   Autophagy - animal rtp04144   Endocytosis rtp04530   Tight junction Brite KEGG Orthology (KO) [BR:rtp00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     109920697 (rab8a)    04140 Autophagy - animal     109920697 (rab8a)   09144 Cellular community - eukaryotes    04530 Tight junction     109920697 (rab8a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rtp04131]     109920697 (rab8a)    03036 Chromosome and associated proteins [BR:rtp03036]     109920697 (rab8a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rtp04147]     109920697 (rab8a)    04031 GTP-binding proteins [BR:rtp04031]     109920697 (rab8a) Membrane trafficking [BR:rtp04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     109920697 (rab8a)  Autophagy   Other autophagy associated proteins     109920697 (rab8a) Chromosome and associated proteins [BR:rtp03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     109920697 (rab8a) Exosome [BR:rtp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109920697 (rab8a)   Exosomal proteins of other body fluids (saliva and urine)    109920697 (rab8a)   Exosomal proteins of colorectal cancer cells    109920697 (rab8a) GTP-binding proteins [BR:rtp04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     109920697 (rab8a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU DUF3963 Gtr1_RagA DUF6974 Tor_FN3_2nd Motif Other DBs NCBI-GeneID:  109920697 NCBI-ProteinID:  XP_048470061 LinkDB All DBs Position 29:518462..542984 Genome browser AA seq 168 aa AA seqDB search MTGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNI KNWIRNIEEHASADVEKMILGNKCDVNEKRQVSKERGEKLASDYGIKFMETSAKANINVE NAFFTLARDIKTKMDKKLEGNSPQGSNQGIRITSQQQKKNTFFRCLLL NT seq 507 nt NT seq  +upstreamnt  +downstreamnt atgacaggtattgattttaaaatccgaacaattgaattggatgggaaaaaaatcaaacta caaatatgggacacagctgggcaggaacgctttcgaacaatcaccactgcatactaccga ggggccatgggaatcatgttggtgtatgatatcacgaatgaaaaatcttttgataacatc aagaactggatccggaatatcgaagagcatgcttctgctgatgtagagaaaatgatcctt gggaacaagtgtgatgtgaatgaaaagaggcaagtcagcaaagaacgtggagagaagtta gccagtgactatggaatcaaattcatggagaccagcgcaaaagcaaatatcaatgtggag aatgcatttttcacacttgccagagacatcaaaacgaaaatggacaagaaactggaaggc aacagtccccaaggcagtaatcaaggcatacgaattacctcacagcagcagaaaaagaac accttctttcgttgtcttcttctgtaa

DBGET integrated database retrieval system