Rhincodon typus (whale shark): 109922896 Help Entry 109922896         CDS       T06055                                  Symbol rab7a Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism rtp  Rhincodon typus (whale shark) Pathway rtp04137   Mitophagy - animal rtp04140   Autophagy - animal rtp04144   Endocytosis rtp04145   Phagosome rtp04148   Efferocytosis rtp05132   Salmonella infection Brite KEGG Orthology (KO) [BR:rtp00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     109922896 (rab7a)    04145 Phagosome     109922896 (rab7a)    04140 Autophagy - animal     109922896 (rab7a)    04137 Mitophagy - animal     109922896 (rab7a)    04148 Efferocytosis     109922896 (rab7a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109922896 (rab7a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rtp04131]     109922896 (rab7a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rtp04147]     109922896 (rab7a)    04031 GTP-binding proteins [BR:rtp04031]     109922896 (rab7a) Membrane trafficking [BR:rtp04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     109922896 (rab7a) Exosome [BR:rtp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109922896 (rab7a)   Exosomal proteins of other body fluids (saliva and urine)    109922896 (rab7a)   Exosomal proteins of colorectal cancer cells    109922896 (rab7a)   Exosomal proteins of bladder cancer cells    109922896 (rab7a) GTP-binding proteins [BR:rtp04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     109922896 (rab7a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_16 AAA_7 NTPase_1 AAA_22 AAA_24 AAA_5 G-alpha ATPase_2 NACHT NB-ARC AAA_14 ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  109922896 NCBI-ProteinID:  XP_048477470 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTAKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRAKTSAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacatctaggaagaaagtcttgctgaaagtcattatcttgggagattcaggggtaggg aaaacctccttgatgaaccagtatgtaaacaaaaaattcagtaaccagtacaaggcaaca ataggagcagactttctcacaaaagaagtgatggtggatgatcgattggtgacaatgcag atctgggatacagctggacaagaacggtttcagtcattgggtgtagcgttctacagagga gctgactgctgtgtgctggtctttgatgtaacggcacccaatacattcaaaacacttgat agctggagggatgagtttctcattcaagctagtccacgagatccagaaaactttccattt gttgtccttggaaacaagattgacttggaaaaccgacaagtcactgcaaaaagagcacag gcatggtgtcagagcaaaaataatatcccatattttgaaaccagtgcaaaggaggcaata aatgtggaacaggcttttcaaacaattgcacggaatgcacttaaacaggaaactgaagtg gaactctacaatgaatttccagaaccaatcaaactagacaagaatgaccgggcaaagact tcagcagagagctgcagctgctga

DBGET integrated database retrieval system