Rhincodon typus (whale shark): 109924000 Help Entry 109924000         CDS       T06055                                  Name (RefSeq) cystatin-B-like   KO K13907   cystatin-A/B Organism rtp  Rhincodon typus (whale shark) Brite KEGG Orthology (KO) [BR:rtp00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:rtp01002]     109924000   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rtp04147]     109924000 Peptidases and inhibitors [BR:rtp01002]  Peptidase inhibitors   Family I25: cystatin family    109924000 Exosome [BR:rtp04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    109924000 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cystatin Motif Other DBs NCBI-GeneID:  109924000 NCBI-ProteinID:  XP_020379606 LinkDB All DBs Position 48:1368445..1371506 Genome browser AA seq 102 aa AA seqDB search MATHCTGGTSGTAAVTAEIQAIVQSLKTEVAERLKRSLPIYHAISYRSQIVAGTNYFIKV VVGEADDYIHMRVFQPLPHSDPKLSLENLQTGKTLFDEIEYF NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atggcaacacattgcactggtggtacatctggtactgcagctgttactgctgagattcag gccattgtccagtcattgaagactgaggttgctgaaaggttgaaaagatctctgccgatt tatcacgctatctcatatcgctcacaaatagtagctggaacaaattacttcatcaaggtt gtggttggggaagctgacgattacatacacatgcgggtgttccagccactgcctcattct gatccgaaactgtctctggaaaacctccaaacgggcaagacactgtttgatgagattgag tacttctag

DBGET integrated database retrieval system