Rhincodon typus (whale shark): 109925048 Help Entry 109925048         CDS       T06055                                  Name (RefSeq) ras-related protein Rab-7a-like   KO K07897   Ras-related protein Rab-7A Organism rtp  Rhincodon typus (whale shark) Pathway rtp04137   Mitophagy - animal rtp04140   Autophagy - animal rtp04144   Endocytosis rtp04145   Phagosome rtp04148   Efferocytosis rtp05132   Salmonella infection Brite KEGG Orthology (KO) [BR:rtp00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     109925048    04145 Phagosome     109925048    04140 Autophagy - animal     109925048    04137 Mitophagy - animal     109925048    04148 Efferocytosis     109925048  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109925048  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rtp04131]     109925048   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rtp04147]     109925048    04031 GTP-binding proteins [BR:rtp04031]     109925048 Membrane trafficking [BR:rtp04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     109925048 Exosome [BR:rtp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109925048   Exosomal proteins of other body fluids (saliva and urine)    109925048   Exosomal proteins of colorectal cancer cells    109925048   Exosomal proteins of bladder cancer cells    109925048 GTP-binding proteins [BR:rtp04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     109925048 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA AAA_16 SRPRB AAA_7 AAA_22 PduV-EutP ABC_tran AAA_24 TniB nSTAND3 AAA_29 Septin HdrB-like_C nSTAND1 DUF815 MCM AAA_14 AAA_5 NACHT FeoB_N ATPase_2 DAP3 Motif Other DBs NCBI-GeneID:  109925048 NCBI-ProteinID:  XP_048475775 LinkDB All DBs Position 44:336821..378498 Genome browser AA seq 204 aa AA seqDB search MTTPVHLKVVLLGDSGVGKSSLMNQYVNKHYTNQYKATIGVDFLNRNITVDGKNVCVQLW DTAGTERFHSLGSFLYRAADCCVLVFDVTSEASFKALDSWRKEFLLQADPRDPDNFPFLV VGNKADLSGSREVISKLAENWCSAHRLKYIETSAKDALNVEEAFQDGVRLALKRLRREDQ IADQFDQVQLMPEEDRQRNACACG NT seq 615 nt NT seq  +upstreamnt  +downstreamnt atgacgacgcctgttcacctgaaggttgtccttctgggcgattctggggtggggaaatca tccctcatgaaccaatacgtgaacaagcattacaccaatcagtacaaggcgactattgga gtggatttcctcaaccgtaacatcactgtcgacggcaaaaacgtgtgtgtgcagctctgg gacacagctggcactgagcgtttccattcgctgggctctttcctgtatagggccgcggat tgctgtgtattggtgtttgatgtgacctcagaggcctccttcaaggcactggatagctgg cgaaaggagttcctgctccaggctgaccccagggatccagacaactttccattcctcgtc gttgggaacaaggctgacctgagcggcagcagagaggttatctcaaagctggcagagaat tggtgcagtgcgcaccgtctgaagtacatcgagaccagtgccaaggatgcgctgaacgtg gaggaggcatttcaagatggcgtacggctcgctttgaagcggctgagaagggaggaccag attgcggaccaatttgaccaggttcagctgatgccagaggaagacagacagcggaacgcc tgtgcttgtggctga

DBGET integrated database retrieval system