Rhincodon typus (whale shark): 109927423 Help Entry 109927423         CDS       T06055                                  Name (RefSeq) 14-3-3 protein zeta-like   KO K16197   14-3-3 protein beta/theta/zeta Organism rtp  Rhincodon typus (whale shark) Pathway rtp04110   Cell cycle rtp04114   Oocyte meiosis rtp04519   Cadherin signaling Brite KEGG Orthology (KO) [BR:rtp00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04519 Cadherin signaling     109927423  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     109927423    04114 Oocyte meiosis     109927423  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:rtp03400]     109927423   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rtp04147]     109927423 DNA repair and recombination proteins [BR:rtp03400]  Eukaryotic type   Check point factors    Other check point factors     109927423 Exosome [BR:rtp04147]  Exosomal proteins   Proteins found in most exosomes    109927423 SSDB OrthologParalogGFIT Motif Pfam:  14-3-3 Motif Other DBs NCBI-GeneID:  109927423 NCBI-ProteinID:  XP_048452461 LinkDB All DBs Position 5:complement(103954219..103963111) Genome browser AA seq 129 aa AA seqDB search MKGDYYRYLAEVASGDQRDGTIKSSQNAYQSAFEISKVGLPSTHPIRLGLALNFSVFFYE ILNSPDCACDLAKTAFDLAIQDLDILQDDSYKDSTLIMQLLRDNLTLWTNENSGSADPEP SAAEPGENN NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgaagggagattattatcggtaccttgctgaagttgcttccggagatcaacgggatgga acaataaagtcctcccaaaatgcttaccagagcgcctttgaaatcagtaaagttggtctg ccatcaacacatccaattcgtttgggtcttgcacttaatttctccgtgttcttctatgaa attctcaactctccagattgtgcctgtgatctggcaaaaaccgcatttgatctggctatt caagatctggatattctacaagatgacagctataaagacagcaccctcattatgcagttg ctcagagataaccttacattatggacaaacgagaattcaggatcagctgatcctgaaccc tctgcagctgagcctggagaaaacaactaa

DBGET integrated database retrieval system