Rhincodon typus (whale shark): 109928393 Help Entry 109928393         CDS       T06055                                  Name (RefSeq) thioredoxin-like isoform X2   KO K03671   thioredoxin Organism rtp  Rhincodon typus (whale shark) Pathway rtp04621   NOD-like receptor signaling pathway rtp05132   Salmonella infection Brite KEGG Orthology (KO) [BR:rtp00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     109928393  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109928393  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:rtp03110]     109928393 Chaperones and folding catalysts [BR:rtp03110]  Protein folding catalysts   Protein disulfide isomerase    109928393 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin DIM1 Thioredoxin_2 OST3_OST6 Thioredoxin_8 Thioredoxin_7 Phosducin AhpC-TSA Glutaredoxin Redoxin Motif Other DBs NCBI-GeneID:  109928393 NCBI-ProteinID:  XP_020383964 LinkDB All DBs Position 3:complement(28728690..28745458) Genome browser AA seq 106 aa AA seqDB search MGVRVLENQKEFEMVLKEAGCKLVVVDFSATWCQPCKNMKPAFLTLAEKHQDVIFCEVDV DDAQDCAESCGIKCMPTFQFYKNGQMVFEFSGANKTTLEDKIQELC NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgggagtgcgggtgctggagaaccaaaaagaatttgaaatggtacttaaggaggcagga tgcaaactggtggttgttgacttctctgcaacatggtgtcagccttgtaaaaacatgaag ccagcattcctaactttggcagagaaacatcaagacgtaattttctgtgaggtagatgtg gatgacgcacaagattgtgctgaaagctgtggcattaaatgcatgccaacattccaattc tacaagaatggacagatggtgtttgaattttctggagccaataaaacaacactggaagac aaaattcaagagttatgctaa

DBGET integrated database retrieval system