Rhincodon typus (whale shark): 109936586 Help Entry 109936586         CDS       T06055                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism rtp  Rhincodon typus (whale shark) Pathway rtp04060   Cytokine-cytokine receptor interaction rtp04218   Cellular senescence rtp04620   Toll-like receptor signaling pathway rtp04621   NOD-like receptor signaling pathway rtp04622   RIG-I-like receptor signaling pathway rtp05132   Salmonella infection Brite KEGG Orthology (KO) [BR:rtp00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109936586  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     109936586  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109936586    04621 NOD-like receptor signaling pathway     109936586    04622 RIG-I-like receptor signaling pathway     109936586  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109936586  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:rtp04052]     109936586    00536 Glycosaminoglycan binding proteins [BR:rtp00536]     109936586 Cytokines and neuropeptides [BR:rtp04052]  Cytokines   Chemokines    109936586 Glycosaminoglycan binding proteins [BR:rtp00536]  Heparan sulfate / Heparin   Chemokines    109936586 SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  109936586 NCBI-ProteinID:  XP_020390777 LinkDB All DBs Position 1:143110502..143114835 Genome browser AA seq 128 aa AA seqDB search MEELDTTAAECSNKENIKTIIQEKTMNSEVTFAILTVFVLYVASTQAASLRHTGMSLRCQ CIKTNSKFIHPKHMENIEIIPSGPHCPTVEIIATLKSGSQVCLDPNAVWVKKIIDMMTNG PKKANKPH NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggaggagttagatacaacagcagcagagtgcagcaacaaagagaatattaagaccatc atacaagaaaagacaatgaacagcgaagttacttttgccatcttgactgtctttgtactt tatgtggcttccacacaagctgcatctcttagacacacaggaatgagcttgcgatgccaa tgtattaaaacaaactccaaattcatccatccaaaacacatggagaatattgaaatcatt ccaagtggtccacattgtccaactgttgaaatcattgcaacccttaaaagtggatcccaa gtgtgtctggatcctaatgccgtttgggtgaaaaagatcattgacatgatgaccaatggt ccgaagaaggctaacaaacctcactga

DBGET integrated database retrieval system