Rhincodon typus (whale shark): 109937464 Help Entry 109937464         CDS       T06055                                  Name (RefSeq) ferritin, heavy subunit-like   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism rtp  Rhincodon typus (whale shark) Pathway rtp00860   Porphyrin metabolism rtp04216   Ferroptosis rtp04217   Necroptosis Brite KEGG Orthology (KO) [BR:rtp00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     109937464  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     109937464    04217 Necroptosis     109937464  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rtp04147]     109937464 Enzymes [BR:rtp01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      109937464 Exosome [BR:rtp04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    109937464   Exosomal proteins of bladder cancer cells    109937464 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ferritin YppF Rubrerythrin Motif Other DBs NCBI-GeneID:  109937464 NCBI-ProteinID:  XP_020391632 LinkDB All DBs Position 37:11945326..11950741 Genome browser AA seq 146 aa AA seqDB search MASQICQNYHQDCEAAVNKQINVELTASYLYQSLMVYFDRHDVALPHFSQFFKDQSQEKQ EHAEKLLKFQNRRGGRVLLQDVKKPERDEWGNSLQAMQVALDLEKNVNQSFLDLHQLATA QTDPHLCDFLDTHYLDEEVKIIKQLG NT seq 438 nt NT seq  +upstreamnt  +downstreamnt atggcctctcagatttgtcagaactatcaccaggattgtgaagctgctgtcaacaaacag attaatgtagagctcactgcctcctatctctatcagtctttgatggtgtactttgaccgg catgatgttgccctcccccatttctcccagttcttcaaagatcagtcccaggagaagcag gaacatgcagagaagctgctgaaattccagaatcggcgtggaggcagagtcctcctccag gatgtgaagaagccagagagggatgagtggggtaacagtctgcaggcaatgcaggttgcc ctggatctggagaagaatgtgaaccagagtttcctggatctacaccaactcgccactgcc cagactgaccctcatctgtgtgacttcctggacactcactatttggatgaggaggtgaag atcatcaagcaacttggg

DBGET integrated database retrieval system