Rhincodon typus (whale shark): 125480937 Help Entry 125480937         CDS       T06055                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism rtp  Rhincodon typus (whale shark) Pathway rtp04060   Cytokine-cytokine receptor interaction rtp04218   Cellular senescence rtp04620   Toll-like receptor signaling pathway rtp04621   NOD-like receptor signaling pathway rtp04622   RIG-I-like receptor signaling pathway rtp05132   Salmonella infection Brite KEGG Orthology (KO) [BR:rtp00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     125480937  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     125480937  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     125480937    04621 NOD-like receptor signaling pathway     125480937    04622 RIG-I-like receptor signaling pathway     125480937  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     125480937  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:rtp04052]     125480937    00536 Glycosaminoglycan binding proteins [BR:rtp00536]     125480937 Cytokines and neuropeptides [BR:rtp04052]  Cytokines   Chemokines    125480937 Glycosaminoglycan binding proteins [BR:rtp00536]  Heparan sulfate / Heparin   Chemokines    125480937 SSDB OrthologParalogGFIT Motif Pfam:  IL8 SNN_transmemb DUF4148 Motif Other DBs NCBI-GeneID:  125480937 NCBI-ProteinID:  XP_020387302 LinkDB All DBs Position 1:111743306..111746141 Genome browser AA seq 96 aa AA seqDB search MNRATVIMTVILLLCAIAAQGIPILDTQGRCQCPRTSSDFINPKIIKNLQYIPKGPHCET QEIIITTKKGQRFCVSPDAEWVKIIIRSRKGSRPRN NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgaacagagcaacagttataatgactgtcatcctgctcctgtgtgctattgctgcacag ggtattccaatcctagatacccaaggacggtgtcagtgtcccaggaccagctctgatttt atcaatccaaagatcatcaagaatttacaatacattcccaaaggaccacattgtgagaca caagagataatcatcaccacgaaaaaagggcagagattttgtgtgagccctgatgccgag tgggtgaagattatcattagatccaggaaaggttccaggccacgaaactaa

DBGET integrated database retrieval system