Rhincodon typus (whale shark): 125488169 Help Entry 125488169         CDS       T06055                                  Name (RefSeq) histone H2B 7-like   KO K11252   histone H2B Organism rtp  Rhincodon typus (whale shark) Brite KEGG Orthology (KO) [BR:rtp00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:rtp03036]     125488169   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rtp04147]     125488169 Chromosome and associated proteins [BR:rtp03036]  Eukaryotic type   Nucleosome assembly factors    Histones     125488169 Exosome [BR:rtp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    125488169 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa LonB_AAA-LID YscO-like CENP-T_C Motif Other DBs NCBI-GeneID:  125488169 NCBI-ProteinID:  XP_048477041 LinkDB All DBs Position Unknown AA seq 81 aa AA seqDB search MKQVHPDTGISSKAMSIMNSFVNDIFERIAGEASCLAHYNKRSTISSREIQTAVRLLLPG ELAKHAVSEGTKAVTKYTSSK NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaagcaggttcaccccgacaccggcatctcctccaaggctatgagcatcatgaactca ttcgtcaacgatattttcgagcgcatcgcgggggaagcttcctgcctggcccattacaac aagcgcagcaccatcagctcccgggagatccagaccgccgtgcggctgctgctgccaggg gagttggccaagcacgccgtgtcggagggtacaaaggcggtgaccaagtacaccagttcc aagtga

DBGET integrated database retrieval system