Raoultibacter timonensis: CE91St31_03420 Help Entry CE91St31_03420    CDS       T08072                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism rts  Raoultibacter timonensis Pathway rts03060   Protein export rts03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:rts00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     CE91St31_03420  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     CE91St31_03420  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:rts02044]     CE91St31_03420 Secretion system [BR:rts02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    CE91St31_03420 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Synaphin Motif Other DBs NCBI-ProteinID:  BDF49612 LinkDB All DBs Position 418534..418812 Genome browser AA seq 92 aa AA seqDB search MKILGMGVPELLIILAVVLLIFGPKHLPKLGAAVGSTVKNLREGLGGDKQIEEVADEIVE MEEEEPEEAPAKKTVKTTTAKKVATKKAVVAD NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaaaattctcggcatgggtgttcccgagctccttattatcctggcagtcgtgttgctc atcttcgggccgaagcatctccccaagctcggcgctgcagttgggtcgacggtaaagaac cttcgcgaaggcctcggtggcgacaagcagattgaagaagtcgccgacgagatcgtcgag atggaagaagaggagccggaagaggctcccgcgaagaagaccgtgaagaccacgaccgct aagaaagtggcaacgaagaaagcagtcgttgccgactag

DBGET integrated database retrieval system