Rhizobium tumorigenes: PR017_04285 Help Entry PR017_04285       CDS       T08990                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rtu  Rhizobium tumorigenes Pathway rtu01100   Metabolic pathways rtu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rtu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PR017_04285    00074 Mycolic acid biosynthesis     PR017_04285   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PR017_04285 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Delta_lysin Motif Other DBs NCBI-ProteinID:  WFR96358 UniProt:  A0AAF1K5B4 LinkDB All DBs Position 867739..867975 Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVVDHLGVDAEKVVEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA DSILTVGDAVKFIEKAQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcagaacgcgttaagaaaattgttgttgatcatcttggcgtcgacgcc gaaaaggttgttgaaggcgccagcttcatcgacgacctgggtgcggactcgctcgacaca gtcgaactggtcatggcattcgaagaagaattcggcgttgaaatcccggacgacgctgcc gactcgattctgacggttggcgacgctgtaaagttcatcgaaaaggcccaggcttaa

DBGET integrated database retrieval system