Rufibacter radiotolerans: TH63_15380 Help Entry TH63_15380        CDS       T03996                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ruf  Rufibacter radiotolerans Pathway ruf01100   Metabolic pathways ruf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ruf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     TH63_15380    00074 Mycolic acid biosynthesis     TH63_15380   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     TH63_15380 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding AlkZ-rel PP-binding_2 TFIID_20kDa TctC Motif Other DBs NCBI-ProteinID:  AKQ46691 UniProt:  A0A0H4W8C0 LinkDB All DBs Position complement(3791687..3791944) Genome browser AA seq 85 aa AA seqDB search MIPVYTPSITKEVVKIISKTKEIKASRLRASANLSKEFGFDTVDVVDIILELEKSFKIVI PDEVPLNTVGDFVEYVSTHTMRQAS NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgatacctgtatataccccctccatcaccaaagaggtagttaaaataatcagcaagact aaggagatcaaagcctcccggcttcgggcttccgctaatcttagcaaagagtttgggttt gataccgtagacgtggtggacattatcctggagctggaaaagagcttcaaaattgtgatt ccagacgaggtgcccttaaacaccgtgggtgactttgtggagtatgtctctacccatacc atgcgtcaggcgagttaa

DBGET integrated database retrieval system