Rugamonas sp. DEMB1: QC826_04545 Help Entry QC826_04545       CDS       T08988                                  Symbol groES Name (GenBank) co-chaperone GroES   KO K04078   chaperonin GroES Organism rug  Rugamonas sp. DEMB1 Brite KEGG Orthology (KO) [BR:rug00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:rug03110]     QC826_04545 (groES)    03029 Mitochondrial biogenesis [BR:rug03029]     QC826_04545 (groES) Chaperones and folding catalysts [BR:rug03110]  Heat shock proteins   HSP10    QC826_04545 (groES) Mitochondrial biogenesis [BR:rug03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     QC826_04545 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 ExoX-like_C Motif Other DBs NCBI-ProteinID:  WGG51530 LinkDB All DBs Position complement(1002572..1002862) Genome browser AA seq 96 aa AA seqDB search MNLRPLNDRVIVKRLDQETKTASGLIIPDAAAEKPDQGEVLAVGNGKILEDGKVRPLDVK VGDRVLFGKYAGQTVKVDGQELMVMREEDIMAIVVK NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgaaccttcgccctttgaacgatcgcgtcatcgtcaaacgtctcgaccaggaaaccaaa accgcgtccggcctgatcatccctgatgcagccgctgaaaaaccggaccaaggcgaagtg ctcgccgtaggcaatggcaagatcctggaagacggcaaagtccgtccgctggatgtcaaa gtaggcgaccgcgtcctgttcggcaaatacgccggccagaccgtcaaagttgacggccag gaactgatggtcatgcgcgaagaagacatcatggcgatcgtcgtcaagtaa

DBGET integrated database retrieval system