Roseimaritima ulvae: UC8_15680 Help Entry UC8_15680         CDS       T06179                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism rul  Roseimaritima ulvae Pathway rul00998   Biosynthesis of various antibiotics rul01100   Metabolic pathways rul01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rul00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     UC8_15680    00074 Mycolic acid biosynthesis     UC8_15680   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     UC8_15680 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QEG39572 UniProt:  A0A5B9QNU7 LinkDB All DBs Position 2161641..2161889 Genome browser AA seq 82 aa AA seqDB search MFNGRDVRRVASEPYIPHRRRTFVTSAVRCCRNASATLSERYDSWNPTDIWKVLQLIIVE QLGVPKDDGTPNTSFVYDLGCD NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgttcaacggtcgcgacgttcgacgcgttgcgtcggagccttacattccacatcgacgg cggacgttcgttacgtccgccgtccgatgttgccgcaatgcttccgcgacactgtccgaa cgatacgactcatggaacccaaccgacatctggaaggttctgcagttgattatcgttgaa cagctcggcgtcccgaaggacgatggcacgcccaataccagctttgtctatgacctgggc tgcgactga

DBGET integrated database retrieval system