Roseimaritima ulvae: UC8_49090 Help Entry UC8_49090         CDS       T06179                                  Name (GenBank) Anti-sigma-28 factor, FlgM   KO K02398   negative regulator of flagellin synthesis FlgM Organism rul  Roseimaritima ulvae Pathway rul02020   Two-component system rul02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:rul00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     UC8_49090  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     UC8_49090  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:rul02035]     UC8_49090 Bacterial motility proteins [BR:rul02035]  Flagellar system   Flagellar assembly proteins    Others     UC8_49090 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM DUF1627 Motif Other DBs NCBI-ProteinID:  QEG42867 UniProt:  A0A5B9QUY7 LinkDB All DBs Position complement(6764891..6765193) Genome browser AA seq 100 aa AA seqDB search MQIIGPIRVSANQATQGNNRISPAQAQPAQGPRSAAPVDQLDLSSAVQQTGGAAPSEAVA GGGEIRLERVAEIRRAIADGSYETPEKLDAAMSRLLDRLA NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgcaaattatcggccccattcgcgtatcagccaaccaagcgacgcagggcaataatcga atcagcccagcccaagctcaaccggctcagggtccgcgctcggccgcgcccgtcgaccag ttggatctgtcctcggcggtccagcagaccggcggagccgctccatcggaagccgtcgcc ggcggcggagagatccgcctggaacgggtcgctgaaattcgccgggcaatcgccgatggc agttacgaaacgcctgaaaagctagacgcggcgatgagtcgcttgctcgaccggctggcc tag

DBGET integrated database retrieval system