Ruminococcus sp. SR1/5: CK1_01610 Help Entry CK1_01610         CDS       T02601                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rum  Ruminococcus sp. SR1/5 Pathway rum01100   Metabolic pathways rum01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rum00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CK1_01610    00074 Mycolic acid biosynthesis     CK1_01610   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CK1_01610 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1493 Ribosomal_L50 Ribosomal_L12_N WLS_GOLD Motif Other DBs NCBI-ProteinID:  CBL18531 LinkDB All DBs Position 140593..140826 Genome browser AA seq 77 aa AA seqDB search MLEKMKEMLAEQLNCEASTITPETSFKDDLGADSLDLFELVMALEDEYNVEIPAEELTDL NTVGDVIDYLKNKGVEA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgttagaaaaaatgaaagaaatgcttgcagagcagttaaattgtgaggcatcaacaatt acaccggagacatctttcaaggatgatcttggagcagattctcttgacctgtttgagctg gttatggctcttgaggatgagtacaatgttgagatcccggcagaggagcttacagatctg aacacagttggagatgtgatcgattatcttaagaacaaaggcgtagaagcataa

DBGET integrated database retrieval system