KEGG   Ruegeria sp. THAF33: FIU92_02730
Entry
FIU92_02730       CDS       T06269                                 
Symbol
rnc
Name
(GenBank) Ribonuclease 3
  KO
K03685  ribonuclease III [EC:3.1.26.3]
Organism
rut  Ruegeria sp. THAF33
Brite
KEGG Orthology (KO) [BR:rut00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    FIU92_02730 (rnc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rut03019]
    FIU92_02730 (rnc)
   03009 Ribosome biogenesis [BR:rut03009]
    FIU92_02730 (rnc)
   03036 Chromosome and associated proteins [BR:rut03036]
    FIU92_02730 (rnc)
Enzymes [BR:rut01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.3  ribonuclease III
     FIU92_02730 (rnc)
Messenger RNA biogenesis [BR:rut03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     FIU92_02730 (rnc)
Ribosome biogenesis [BR:rut03009]
 Eukaryotic type
  90S particles
   RNase
    FIU92_02730 (rnc)
 Prokaryotic type
  rRNA processing factors
   FIU92_02730 (rnc)
Chromosome and associated proteins [BR:rut03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Microprocessor complex
     FIU92_02730 (rnc)
SSDB
Motif
Pfam: Ribonucleas_3_3 Ribonuclease_3 dsrm RM44_endonuclase DSRM_2 Orthopox_F8
Other DBs
NCBI-ProteinID: QFT71925
LinkDB
Position
521162..521854
AA seq 230 aa
MKLSAEIKAFQRRLGYEFKNPELLVRALTHGSVSSSTRPDNQRLEFLGDRVLGLVMATAL
LEADKKASEGQLAPRFNALVRKEACADVARQIDLGAVLKLGRSEMLSGGRRKQALLGDAM
EAVIAAIYRDAGFEAARDVILALWGDRIHKVEADARDAKTSLQEWAQARGQKPPSYVEVK
RSGPDHAPIFTIAARLQDGTEAQATAGSKRQAEQAAAKALLEQLSPAGSS
NT seq 693 nt   +upstreamnt  +downstreamnt
ttgaagctctcggctgaaataaaggcgttccagcggcgattggggtatgagttcaaaaac
cccgaactgctggtgcgcgcgctgacccatggctcggtgtcttcgtccacccgacccgac
aatcagcggctggagtttctgggagaccgcgttctgggcctggtcatggccactgcgctg
cttgaggccgacaaaaaggcgtccgagggtcagttggccccacggttcaatgcactggtc
cgcaaagaggcttgcgctgatgtagcccgtcagattgatctgggcgcggtgttgaaactc
ggccggtccgagatgctgtccggtggccgtcgcaagcaagcgctgctgggcgacgcgatg
gaggccgtgatcgccgccatctatcgggatgccgggttcgaggctgcccgcgatgtcatt
ctggcgctttggggggaccgcatccacaaggtcgaggcagatgcgcgtgacgccaagacc
tctttgcaggaatgggcgcaggcgcgtgggcaaaagccgccctcatacgtcgaggttaaa
cgcagtggcccggaccacgccccgatcttcaccattgcggcccgccttcaggacggcacc
gaggcgcaagccactgcaggatccaaacgtcaggccgaacaggcggcggcgaaagctctg
ctggaacagctcagcccggccgggtcttcctag

DBGET integrated database retrieval system