KEGG   Ruegeria sp. THAF33: FIU92_04410
Entry
FIU92_04410       CDS       T06269                                 
Symbol
artM
Name
(GenBank) Arginine transport ATP-binding protein ArtM
  KO
K02041  phosphonate transport system ATP-binding protein [EC:7.3.2.2]
Organism
rut  Ruegeria sp. THAF33
Pathway
rut02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:rut00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    FIU92_04410 (artM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rut02000]
    FIU92_04410 (artM)
Enzymes [BR:rut01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.2  ABC-type phosphonate transporter
     FIU92_04410 (artM)
Transporters [BR:rut02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    FIU92_04410 (artM)
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_16 AAA_29 AAA_22 Rad17 RsgA_GTPase AAA_30 SbcC_Walker_B AAA_PrkA AAA_25 AAA_33 nSTAND1 Mg_chelatase TsaE AAA_19 AAA_23
Other DBs
NCBI-ProteinID: QFT72260
LinkDB
Position
846007..846801
AA seq 264 aa
MLRLQKLTKTYKTGDRALKAIDLEVPKGQVLALIGPSGAGKSTMIRCVNRLVEPTSGGVL
LDDVDVTKLGSGALRKARRQMGMIFQEYALVERLTVMENVLSGRLGYVGFWRSFLRRYPQ
SDVDEAFRLLDRVGLLHMADKRADELSGGQRQRVGICRALIQNPKLLLVDEPTASLDPKT
SRQIMRLITELCQERGLAAIINIHDVALAQMFVPRVVGLRFGEIVYDGLPTGLTPEKLTE
IYGEEDWEATIEKVDEDEDVEAAE
NT seq 795 nt   +upstreamnt  +downstreamnt
atgctgcgtcttcaaaagctgacgaaaacatacaagaccggagatcgggccctgaaggcg
atcgatcttgaggttcccaaaggacaggttctggcgttgatcgggccctcgggcgcgggc
aaatcgaccatgatccgctgtgtcaaccggttggttgaaccgacaagcggcggtgtcctt
ctggatgacgttgacgtgaccaaactcggatcgggcgcgctgaggaaagcacgccgccaa
atgggcatgatctttcaggaatatgcgttggtcgaacgcctcacggtgatggaaaacgta
ttgtccggcaggctgggatacgtgggattctggcgcagtttcctgcggcggtatccgcaa
tcggacgtggacgaagcctttcgcttgcttgatcgggtggggctgctgcacatggcggac
aaacgggcggatgaactgtcgggtggtcaacgccaaagggtgggcatctgccgcgccttg
attcaaaacccgaaactgttgctggtcgatgagccaaccgcatcgctggacccaaagacc
agccgtcaaatcatgcggctgatcaccgagttatgtcaggaacgcggattggcagccatc
atcaatatccatgatgtggcgctcgctcagatgtttgttccccgcgtcgtggggctccga
tttggcgaaatcgtgtatgatgggcttcccaccggcctcacccctgagaagctgaccgag
atctatggggaagaggactgggaagcaaccatcgaaaaagtggacgaagatgaagatgtc
gaggccgcagaatga

DBGET integrated database retrieval system