Ruegeria sp. THAF33: FIU92_07720 Help Entry FIU92_07720       CDS       T06269                                  Symbol acpP1 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism rut  Ruegeria sp. THAF33 Pathway rut01100   Metabolic pathways rut01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rut00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FIU92_07720 (acpP1)    00074 Mycolic acid biosynthesis     FIU92_07720 (acpP1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FIU92_07720 (acpP1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  QFT72912 LinkDB All DBs Position complement(1518965..1519222) Genome browser AA seq 85 aa AA seqDB search MSISDRVIAIIAEQAVLEPSDVTPESTLEDLGIDSLGLVESIFAIEEEFDISIPFNANEP EANDFDISNVAAIIAGIEKLVSEKV NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgagcatcagcgaccgcgtcatcgcaatcattgcagagcaggccgtgctggagccatcg gatgtgacgcccgaaagcacgctggaagatctgggaatcgacagccttggtctggtcgaa agtattttcgccatcgaggaagagttcgacatttcaattccgttcaacgccaacgaaccc gaggccaacgattttgacatatccaatgtcgctgcgatcattgccgggatcgaaaagctc gtgtcggaaaaggtctga

DBGET integrated database retrieval system