KEGG   Rosistilla ulvae: EC9_17470
Entry
EC9_17470         CDS       T09881                                 
Symbol
nreB_1
Name
(GenBank) Oxygen sensor histidine kinase NreB
Organism
ruv  Rosistilla ulvae
Pathway
ruv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ruv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EC9_17470 (nreB_1)
SSDB
Motif
Pfam: HATPase_c HisKA_3 HATPase_c_3 HATPase_c_2
Other DBs
NCBI-ProteinID: QDS87568
UniProt: A0A517LY76
LinkDB
Position
2308046..2308693
AA seq 215 aa
MSDQENLSNHSATELAELERTWMSHELHDGLMQWVVGAKMQAESLHARSMDGKPPTADQL
QYLGTLLSRAVLEGRRLMAGLRPPELDESDWHVALTHWANIARTGCQTAVEFNLDPATRV
VSDAMQRCVYRIVQESVGNALRHAKAENVRVDAKFVDSDLVITVQDDGIGFDQVSVGADR
YGLKGIHERAALLDGSATVQSQVGSGTRIEVTLPR
NT seq 648 nt   +upstreamnt  +downstreamnt
atgagcgatcaagagaatctttcgaatcattccgctaccgaattggcggaactggagcgg
acttggatgtcccacgagctgcatgatggtttgatgcagtgggtggtgggggccaagatg
caagccgaatcgctgcatgcccgcagcatggatggcaagcctcccacagctgaccaattg
cagtatctcggcacgctactgtcgcgcgccgtcttggaagggcggcggttgatggcggga
ctgcggccgccggaattggatgaatcggattggcacgttgcgttgactcattgggccaat
atcgctcgcaccggttgccaaaccgctgtcgaatttaacctcgaccccgcgacccgcgtt
gtcagcgatgcgatgcaacgctgtgtctaccggatcgtccaggaatcggtcggcaacgcg
ctgcggcatgccaaagcggagaacgtccgggtcgatgcaaagtttgtcgacagcgacttg
gtcatcaccgtgcaagacgatgggataggattcgatcaagtgagtgtgggcgccgaccgc
tacggactcaaagggattcacgaacgagctgccctactcgacggctccgcaacggttcag
tcgcaggtgggcagcggcacaagaatcgaagtcaccctaccacgctga

DBGET integrated database retrieval system