Ruegeria sp. YS9: NOR97_02435 Help Entry NOR97_02435       CDS       T10219                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism ruy  Ruegeria sp. YS9 Pathway ruy00190   Oxidative phosphorylation ruy01100   Metabolic pathways Module ruy_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:ruy00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     NOR97_02435  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:ruy00194]     NOR97_02435 Photosynthesis proteins [BR:ruy00194]  Photosystem and electron transport system   F-type ATPase [OT]    NOR97_02435 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  UUV06627 LinkDB All DBs Position 1:460269..460493 Genome browser AA seq 74 aa AA seqDB search MEGDLAHIGAGLAAIGSGAAAIGVGNVAGNFLAGALRNPSAAASQTATLFIGIAFAEALG IFAFLVSLLLMFAV NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggaaggcgatctcgcacacatcggcgcaggcctggcagcaatcggttccggcgcagcc gcaatcggggtgggcaacgtagcaggcaacttcctggccggcgccctgcgcaacccttcg gcggctgcttcgcagaccgcgaccctgttcatcggtatcgcattcgcagaagcgctgggc atcttcgcattcctggtctcgctgctgctgatgttcgccgtctga

DBGET integrated database retrieval system