Ruegeria sp. YS9: NOR97_07675 Help Entry NOR97_07675       CDS       T10219                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ruy  Ruegeria sp. YS9 Pathway ruy01100   Metabolic pathways ruy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ruy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NOR97_07675    00074 Mycolic acid biosynthesis     NOR97_07675   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NOR97_07675 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  UUV07621 LinkDB All DBs Position 1:complement(1506118..1506375) Genome browser AA seq 85 aa AA seqDB search MSISDRVIAIIAEQAVLEPSDVTPESTLEDLGIDSLGLVESIFAIEEEFDISIPFNANEP EANDFDISNVAAIIAGIEKLVSEKV NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgagcatcagcgaccgcgtcatcgcaatcattgcagagcaggccgtgctggagccatcg gacgtgacgcccgaaagcacgctggaagatctgggaatcgacagccttggtctggtcgaa agcatattcgccatcgaggaagagttcgacatttcaattccgttcaacgccaatgaaccc gaggccaacgattttgatatctcgaatgttgctgcgatcattgccgggatcgaaaagctc gtgtcggaaaaggtctga

DBGET integrated database retrieval system