Ruegeria sp. YS9: NOR97_15070 Help Entry NOR97_15070       CDS       T10219                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism ruy  Ruegeria sp. YS9 Brite KEGG Orthology (KO) [BR:ruy00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ruy03032]     NOR97_15070    03036 Chromosome and associated proteins [BR:ruy03036]     NOR97_15070    03400 DNA repair and recombination proteins [BR:ruy03400]     NOR97_15070 DNA replication proteins [BR:ruy03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     NOR97_15070 Chromosome and associated proteins [BR:ruy03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     NOR97_15070 DNA repair and recombination proteins [BR:ruy03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       NOR97_15070 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-CCDC81_euk_2 HU-CCDC81_bac_2 DUF2267 HU-HIG Motif Other DBs NCBI-ProteinID:  UUV05923 LinkDB All DBs Position 1:2976757..2977044 Genome browser AA seq 95 aa AA seqDB search MAKPMTKTQLVAALAEEMGTDKKSANSALEAITGLITREVSAGGAVTLPGVGKIYCRERP ERQVRNPATGETFTKEADKVVKMTIAKALKDSVNG NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggcaaagcctatgacaaagactcagctggttgctgctctcgctgaggaaatgggaacc gacaagaaatccgcgaactccgcgctggaggccatcaccggcctgatcacccgcgaagtt tcggccggtggcgcagtgaccctgcccggcgtcggaaaaatctactgccgcgaacgcccc gagcgtcaggttcgcaacccggccactggtgagaccttcaccaaagaagccgacaaggtt gtgaaaatgaccatcgccaaagcgctgaaagacagcgtgaacggctga

DBGET integrated database retrieval system