Rahnella victoriana: J9880_16405 Help Entry J9880_16405       CDS       T07871                                  Name (GenBank) DinI-like family protein   KO K12149   DNA-damage-inducible protein I Organism rvc  Rahnella victoriana Brite KEGG Orthology (KO) [BR:rvc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:rvc03400]     J9880_16405 DNA repair and recombination proteins [BR:rvc03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     J9880_16405 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI LPD29 Motif Other DBs NCBI-ProteinID:  UHM89872 LinkDB All DBs Position complement(3543006..3543242) Genome browser AA seq 78 aa AA seqDB search MHVELLIDKTKQLPAGAVEAFKVEFEQRLERNYPGATFSVRRAGSDGMSVMGGTTHDKEV IDVMLQDTWESADDWYQP NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgcacgttgaattgctgatcgataaaaccaagcaactgcccgccggcgcggtcgaggct ttcaaagttgagtttgagcaaaggctggaaagaaattacccgggcgctacgttcagcgtt cgccgagctggcagtgatgggatgtcggtgatgggcgggacgactcatgataaagaagtg attgatgtgatgctgcaggatacgtgggaaagcgcggacgattggtatcagccttaa

DBGET integrated database retrieval system