Rhododendron vialii: 131300304 Help Entry 131300304         CDS       T09330                                  Name (RefSeq) SKP1-like protein 1   KO K03094   S-phase kinase-associated protein 1 Organism rvl  Rhododendron vialii Pathway rvl03083   Polycomb repressive complex rvl04120   Ubiquitin mediated proteolysis rvl04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:rvl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     131300304    04120 Ubiquitin mediated proteolysis     131300304   09126 Chromosome    03083 Polycomb repressive complex     131300304  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rvl04131]     131300304    04121 Ubiquitin system [BR:rvl04121]     131300304    03036 Chromosome and associated proteins [BR:rvl03036]     131300304 Membrane trafficking [BR:rvl04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     131300304 Ubiquitin system [BR:rvl04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      131300304    Cul7 complex      131300304 Chromosome and associated proteins [BR:rvl03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      131300304   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      131300304 SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ BTB Sdh5 Motif Other DBs NCBI-GeneID:  131300304 NCBI-ProteinID:  XP_058182049 LinkDB All DBs Position 9a:complement(34298224..34298921) Genome browser AA seq 150 aa AA seqDB search MSSEKKLITLQSSDGEVFVIRASVAAQSTTLKNMIEDNCASSTIPVPNVDGKTLAMVMEY CQKHADSESDSDLKTYDTEFLDVDQAVLYRLIMAANYLDVRELLDSICQKVADMIKGKTP EQIRKTFNIDNDFTPEEEEEVRKANAWAFE NT seq 453 nt NT seq  +upstreamnt  +downstreamnt atgtcttcggagaagaaactaattaccttgcagagctccgatggcgaggtgttcgtgatc agagcttccgtcgcggcccaatccacgacgctcaagaacatgatcgaggacaactgcgcg tccagcaccattcccgtgcccaacgtggacgggaagaccctcgccatggtgatggagtac tgccagaagcacgcggactcggaatccgacagcgacctgaaaacgtacgacacggagttc ttggacgtagaccaggcggttctgtaccgcctgatcatggccgccaactacctcgacgtc agggaactgctggactcgatttgtcagaaagtcgccgacatgatcaaggggaagacgccc gagcagatcaggaagacgttcaacattgacaacgattttactcccgaggaagaagaggaa gttcgtaaggcgaatgcgtgggctttcgagtga

DBGET integrated database retrieval system