Rhododendron vialii: 131306747 Help Entry 131306747         CDS       T09330                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism rvl  Rhododendron vialii Pathway rvl04145   Phagosome rvl04148   Efferocytosis rvl04517   IgSF CAM signaling rvl04518   Integrin signaling rvl04620   Toll-like receptor signaling pathway rvl05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:rvl00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     131306747    04518 Integrin signaling     131306747  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     131306747    04148 Efferocytosis     131306747  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     131306747  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     131306747  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rvl04131]     131306747   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rvl04147]     131306747    04031 GTP-binding proteins [BR:rvl04031]     131306747 Membrane trafficking [BR:rvl04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     131306747  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     131306747   Macropinocytosis    Ras GTPases     131306747  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     131306747 Exosome [BR:rvl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    131306747   Exosomal proteins of other body fluids (saliva and urine)    131306747   Exosomal proteins of colorectal cancer cells    131306747   Exosomal proteins of bladder cancer cells    131306747 GTP-binding proteins [BR:rvl04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     131306747 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  131306747 NCBI-ProteinID:  XP_058189150 LinkDB All DBs Position 11a:38591445..38594914 Genome browser AA seq 198 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENISKKWIPELRHYAPGVPIVLVGTKL DLREDKQFFVEHPGAVPITTAQGEELKKLIGAAAYIECSSKTQQNVKAVFDAAIKVVLQP PKQKKKKKKRGHKGCGIL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgagcgcgtcgaggttcataaagtgcgtcaccgtcggcgacggagctgtcggaaagact tgtatgcttatctcctacaccagcaacaccttccccactgattatgtgccaactgtattt gacaattttagtgccaacgtggtggtggatgggagcactgttaatttagggctgtgggat acagcaggtcaggaggactacaatagattaagaccactgagctatcgtggggccgatgtc tttatacttgcattttctctgattagcaaggccagctacgaaaatatatcaaaaaagtgg attcctgagttgaggcattatgctcctggggttccaatagttcttgttggaacaaagctg gatcttcgggaagataagcagttctttgtagagcaccctggtgccgtgcccattacgaca gctcagggagaggagctgaaaaagctgattggagctgctgcttacattgaatgtagttct aagacccaacagaatgtgaaggctgttttcgacgcggctatcaaggtggttctccaacca ccaaaacagaagaagaaaaagaagaaaagggggcacaagggctgtggaatattgtaa

DBGET integrated database retrieval system