Rhododendron vialii: 131320353 Help Entry 131320353         CDS       T09330                                  Name (RefSeq) polyubiquitin 9 isoform X1   KO K03873   elongin-B Organism rvl  Rhododendron vialii Pathway rvl04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:rvl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     131320353  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:rvl04121]     131320353    03400 DNA repair and recombination proteins [BR:rvl03400]     131320353 Ubiquitin system [BR:rvl04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      131320353    Cul5 complex      131320353 DNA repair and recombination proteins [BR:rvl03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      131320353 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Dsc3_N Ubiquitin_2 Rad60-SLD_2 Ubiquitin_5 Motif Other DBs NCBI-GeneID:  131320353 NCBI-ProteinID:  XP_058207024 LinkDB All DBs Position 3a:complement(34957924..35021565) Genome browser AA seq 104 aa AA seqDB search MAMYIRVKRSKTTYFLQCDPTETILDIKQKLHPLIDQPANDQRLTLVETGEVLDDSKTLA DQKVENDAVVALTLRKDDNEFEDVNIVRPNDFYQSRDADGATNW NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atggcgatgtacattcgtgtcaagcgtagcaagactacctactttctgcagtgtgatcca acggagacaattcttgacattaagcagaagttgcacccccttattgatcaacctgctaat gatcagcgcttgactcttgtggaaaccggtgaagtgttagatgattcaaaaacgttggca gatcagaaggttgagaatgatgctgtggtcgctctgaccctgagaaaagatgacaatgaa tttgaggatgtaaacattgtacggccaaatgacttctaccaatcccgtgatgcagatggt gccacaaattggtga

DBGET integrated database retrieval system