KEGG   Rhododendron vialii: 131325455
Entry
131325455         CDS       T09330                                 
Name
(RefSeq) mitochondrial import inner membrane translocase subunit TIM17-2-like
  KO
K17795  mitochondrial import inner membrane translocase subunit TIM17
Organism
rvl  Rhododendron vialii
Brite
KEGG Orthology (KO) [BR:rvl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rvl03029]
    131325455
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rvl02000]
    131325455
Mitochondrial biogenesis [BR:rvl03029]
 Mitochondrial protein import machinery
  Inner mambrane
   TIM23 complex
    131325455
Transporters [BR:rvl02000]
 Other transporters
  Primary active transporters [TC:3]
   131325455
SSDB
Motif
Pfam: Tim17 PA2794-like_C
Other DBs
NCBI-GeneID: 131325455
NCBI-ProteinID: XP_058213718
LinkDB
Position
5a:4727578..4728983
AA seq 201 aa
MATPELPENSREPCPDRILDDVGGAFGMGAVGGSAFHFIKGLYNSPGGHRLSGAFQGVRM
NAPRVGGSFAVWGGLFSTFDCTLVYARQKEDPWNSIVAGAATGGLLQVRQGLRASSRSAL
AGGVLLALIEGLGITFNKFMSGQQDMPVVIEDQIPDKSSETTSSSWFGGWFGGKKEEEAK
GFKTEVLESFDSPVPPTFEFK
NT seq 606 nt   +upstreamnt  +downstreamnt
atggcaaccccagaattgccagaaaactcccgagagccctgcccggaccgcatccttgac
gacgtcggtggcgccttcggcatgggcgcggtcggcggatccgccttccacttcatcaag
ggcctttacaactctcccggaggccaccgcctctccggcgccttccagggcgtccgcatg
aacgccccgcgcgtcggcgggagcttcgccgtgtggggcggcctcttctccaccttcgac
tgcaccctggtctacgcccgtcagaaggaggacccgtggaactccatcgtcgccggggcc
gcaaccggcggactcctccaggttcgccagggcctccgcgcctcctcccgctccgccctc
gccggcggcgtgcttcttgctttaattgaagggcttgggattacgtttaataagtttatg
agtgggcagcaggatatgcctgttgtgattgaggatcagattcctgataagtcctccgaa
acgacgtcgtcgtcttggttcggcggttggttcggtgggaagaaggaggaggaagcgaaa
ggattcaagacggaggtgttggagagtttcgattcgccggtgccgccgacattcgagttc
aagtga

DBGET integrated database retrieval system