Rhododendron vialii: 131327158 Help Entry 131327158         CDS       T09330                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism rvl  Rhododendron vialii Pathway rvl04145   Phagosome rvl04148   Efferocytosis rvl04517   IgSF CAM signaling rvl04518   Integrin signaling rvl04620   Toll-like receptor signaling pathway rvl05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:rvl00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     131327158    04518 Integrin signaling     131327158  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     131327158    04148 Efferocytosis     131327158  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     131327158  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     131327158  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rvl04131]     131327158   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rvl04147]     131327158    04031 GTP-binding proteins [BR:rvl04031]     131327158 Membrane trafficking [BR:rvl04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     131327158  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     131327158   Macropinocytosis    Ras GTPases     131327158  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     131327158 Exosome [BR:rvl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    131327158   Exosomal proteins of other body fluids (saliva and urine)    131327158   Exosomal proteins of colorectal cancer cells    131327158   Exosomal proteins of bladder cancer cells    131327158 GTP-binding proteins [BR:rvl04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     131327158 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Sua5_C Motif Other DBs NCBI-GeneID:  131327158 NCBI-ProteinID:  XP_058216161 LinkDB All DBs Position 5a:complement(7269413..7275551) Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENISKKWIPELRHYAPGVPVVLVGTKL DLREDKKYYGDHPGAVPITTAQGEELRKLIGAAAYIECSSKTQLNVKAVFDAAIKVVLQP PKQKKKKKKGRNACNFL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagcgcgtcgaggttcataaagtgcgtcacagtcggggacggagctgtgggaaagact tgtatgcttatctcctacaccagcaacactttccctactgactacgtgccaactgttttt gacaattttagtgcaaatgtggttgtggatgggagcacggttaacttagggctgtgggat actgcaggtcaagaggattacaataggttaagacctctgagctatcgcggggctgatgtc tttatacttgcattctctctcattagcaaggccagttatgaaaatatatcaaaaaagtgg attcctgaattgaggcattatgctcctggggtcccagtggttcttgttggaacaaaactt gatcttcgggaggacaagaaatactatggtgaccaccctggtgcggtgcccattacaaca gctcagggagaggaactgagaaagctaatcggagcagctgcttatatcgaatgtagttca aaaacccagctgaatgtgaaggctgtattcgatgcggctataaaggtggtgctccaacca ccaaagcagaagaagaaaaagaagaagggacgcaacgcctgtaatttcttgtaa

DBGET integrated database retrieval system