Rhododendron vialii: 131329556 Help Entry 131329556         CDS       T09330                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism rvl  Rhododendron vialii Pathway rvl04145   Phagosome rvl04148   Efferocytosis rvl04517   IgSF CAM signaling rvl04518   Integrin signaling rvl04519   Cadherin signaling rvl04620   Toll-like receptor signaling pathway rvl05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:rvl00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     131329556    04518 Integrin signaling     131329556    04519 Cadherin signaling     131329556  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     131329556    04148 Efferocytosis     131329556  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     131329556  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     131329556  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rvl04131]     131329556   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rvl04147]     131329556    04031 GTP-binding proteins [BR:rvl04031]     131329556 Membrane trafficking [BR:rvl04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     131329556  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     131329556   Macropinocytosis    Ras GTPases     131329556  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     131329556 Exosome [BR:rvl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    131329556   Exosomal proteins of other body fluids (saliva and urine)    131329556   Exosomal proteins of colorectal cancer cells    131329556   Exosomal proteins of bladder cancer cells    131329556 GTP-binding proteins [BR:rvl04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     131329556 SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  131329556 NCBI-ProteinID:  XP_058218722 LinkDB All DBs Position 6a:complement(2190904..2195619) Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL DLRDNKQFFVDHPGAVPITTAQGEELKKLIGAPAYIECSSKTQQNVKAVFDAAIKVVLQP PKQKKKKRKAQKGCSFL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagtgcgtcgaggttcataaagtgcgtgacggtcggtgacggcgccgtcggcaagact tgcatgctgatttcctacaccagtaacactttccccacggattacgtgccaactgttttt gacaatttcagtgccaatgtggttgtggatgggagcactgtcaatcttggtttatgggac actgctggtcaggaggactacaatagactaagacctttaagttatcgtggagcagatgtg tttcttcttgcattttctctcattagcaaggccagctatgaaaatgttgcaaagaagtgg attcctgaactgaggcattatgcacctggtgttccaataattcttgttggaacaaagctt gatctcagggataataagcagttctttgtagaccaccctggtgcagtgcccattacgaca gctcagggagaggaactgaagaaactgatcggagctcctgcctacatcgaatgtagttca aagacgcaacagaatgtgaaagcagttttcgacgcagccattaaggtagtgctccaacca cccaagcaaaagaaaaagaagagaaaggcacaaaagggttgctcctttttatga

DBGET integrated database retrieval system