Rhododendron vialii: 131329556 Help Entry 131329556         CDS       T09330                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism rvl  Rhododendron vialii Pathway rvl04145   Phagosome rvl04148   Efferocytosis rvl04620   Toll-like receptor signaling pathway rvl05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:rvl00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     131329556    04148 Efferocytosis     131329556  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     131329556  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     131329556  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rvl04131]     131329556   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rvl04147]     131329556    04031 GTP-binding proteins [BR:rvl04031]     131329556 Membrane trafficking [BR:rvl04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     131329556  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     131329556   Macropinocytosis    Ras GTPases     131329556  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     131329556 Exosome [BR:rvl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    131329556   Exosomal proteins of other body fluids (saliva and urine)    131329556   Exosomal proteins of colorectal cancer cells    131329556   Exosomal proteins of bladder cancer cells    131329556 GTP-binding proteins [BR:rvl04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     131329556 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  131329556 NCBI-ProteinID:  XP_058218722 LinkDB All DBs Position 6a:complement(2190904..2195619) Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL DLRDNKQFFVDHPGAVPITTAQGEELKKLIGAPAYIECSSKTQQNVKAVFDAAIKVVLQP PKQKKKKRKAQKGCSFL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagtgcgtcgaggttcataaagtgcgtgacggtcggtgacggcgccgtcggcaagact tgcatgctgatttcctacaccagtaacactttccccacggattacgtgccaactgttttt gacaatttcagtgccaatgtggttgtggatgggagcactgtcaatcttggtttatgggac actgctggtcaggaggactacaatagactaagacctttaagttatcgtggagcagatgtg tttcttcttgcattttctctcattagcaaggccagctatgaaaatgttgcaaagaagtgg attcctgaactgaggcattatgcacctggtgttccaataattcttgttggaacaaagctt gatctcagggataataagcagttctttgtagaccaccctggtgcagtgcccattacgaca gctcagggagaggaactgaagaaactgatcggagctcctgcctacatcgaatgtagttca aagacgcaacagaatgtgaaagcagttttcgacgcagccattaaggtagtgctccaacca cccaagcaaaagaaaaagaagagaaaggcacaaaagggttgctcctttttatga

DBGET integrated database retrieval system